The National Library of Medicine (NLM), on the campus of NIH in Bethesda, ... Losing Belly Fat May Cut Risk of Eye Disease (11/28/08) ... | The Visible Human Project is the creation of anatomically ... Send queries about the Visible Human Project® to: vhp@nlm.nih.gov. Last reviewed: 01 April 2008 ... | Query sequence(s) to be used for a BLAST search should be pasted in the text area. It automatically determines the format or the input. ... | KOGs. TWOGs. LSEs. Kognitor. 3394 LSEs. Functional categories. X. Unassigned. A 2 [X] LSE0605 Predicted transcription factor A 5 [X] LSE0606 Unnamed protein A ... | MT3684 >MT3684 ... | >ZchuS MNHYTRWLELKEQNPGKYARDIAGLMNIREAELAFARVTHDAWRMHGDIREILAALESVGETKCICRNEY ... GPIMALTRNEHCVHERKGPYREVTVSANGQMGLVVSPDIDLRLFLGGWNAVFAIAEETARGTQRSIQVFD ... | >BS_levD MISVIISGHGDFPIALKESSGMIFGEENNLIAVPFFKGEGIQTLQEKYHQALKDIPEEHEVLFLVDIFGG ... yadI MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLSRMMCDALHEADSGEGVIFLTDIAGA ... | | sitemap | sitemap html | qlweb | nlm.nih.gov | kody pocztowe | 404design | hosting | wyroby hutnicze | domeny | fotografia reklamowa | decoupage | cytaty | artyku³y online | php manual | chorwacja | f1, formula 1 | | Dzwonki Mp3 | Fotograf Wroc³aw | Nagrzewnica Wodna | Artystyczna Bi¿uteria | Kêdzierzyn-ko¼le